PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G011300.1
Common NamePHAVU_006G011300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family EIL
Protein Properties Length: 625aa    MW: 70680.9 Da    PI: 5.8823
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G011300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN35161.6e-157504271353
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         +el++rmwkd+mllkrlke++k+    ke  ++a k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+L
  Phvul.006G011300.1  50 DELEHRMWKDKMLLKRLKEQSKS----KEG-IDAVKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNL 135
                         79*******************98....788.************************************************************ PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         r+WWk+kv+fdrngpaai+kyqa+n+i+++++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekg++pPWWPtG+e ww+
  Phvul.006G011300.1 136 REWWKDKVRFDRNGPAAITKYQADNAIPGRNDGCNS-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGIPPPWWPTGNEVWWP 225
                         **********************************88.9***************************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXXX CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.slrkq 270
                         + gl+kdq++ppykkphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++  ++  +  +
  Phvul.006G011300.1 226 QIGLPKDQSPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARELYPDyiPPlASAGG 316
                         *********************************************************************************954444455* PP

                         XXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX..............................XXXXXXXXXXXXXXXXXXXXX......XX CS
                EIN3 271 spkvtlsceqkedvegkkeskikhvqavktta..............................gfpvvrkrkkkpsesakvsskevsrtcqs 331
                         s ++++++++++dveg +++   +v+ +k ++                              ++++ rkrk  + + +++  k   +tc++
  Phvul.006G011300.1 317 SGSLVVNDSNEYDVEGGEDEANFDVEDRKHENihmsnlgmermrgtvvvqqpsfsikgeavtNMDLLRKRKVSSNDFNMMDLK--NYTCEQ 405
                         ***************6555555888888888899*************************************999999999888..69**** PP

                         XXXXX.XXXXXXXXXXXXXXXX CS
                EIN3 332 sqfrgsetelifadknsisqne 353
                          q+++s+++l+f+d+ s+++++
  Phvul.006G011300.1 406 PQCPYSQVQLGFPDRISRDNHR 427
                         *******************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.1E-12950297No hitNo description
Gene3DG3DSA:1.10.3180.101.0E-75170306IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167689.68E-62176300IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MMMMMFDEMG FCNDLDPVPG TLGEENITSG QTDPETIVED DFSDEEIGVD ELEHRMWKDK  60
MLLKRLKEQS KSKEGIDAVK QRQSQEQARR KKMSRAQDGI LKYMLKMMEV CKAQGFVYGI  120
IPEKGKPVTG ASDNLREWWK DKVRFDRNGP AAITKYQADN AIPGRNDGCN SIGPTPHTLQ  180
ELQDTTLGSL LSALMQHCDP PQRRFPLEKG IPPPWWPTGN EVWWPQIGLP KDQSPPPYKK  240
PHDLKKAWKV GVLTAVIKHM SPDIAKIRKL VRQSKCLQDK MTAKESATWL AIINQEEALA  300
RELYPDYIPP LASAGGSGSL VVNDSNEYDV EGGEDEANFD VEDRKHENIH MSNLGMERMR  360
GTVVVQQPSF SIKGEAVTNM DLLRKRKVSS NDFNMMDLKN YTCEQPQCPY SQVQLGFPDR  420
ISRDNHRLIC AFRGPSDFGG PNFHVNEVKP VIYPHSFVQP KPTTAQSANM VPPVIDLTGL  480
EVSEDGKKRI SDLMSNYDTN VQGNSKNISS SCNRVAAEVL NLTQHGMQQQ HDNFIRSRGN  540
TMEGNVFDEA TMSNNHHTFA RDECQFDRFK ALNTPFETNH NNSNFHSMFG SFCDLASFDF  600
KEDMQGVIGM DVVQKQPDFS VWYQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A6e-841753062133Protein ETHYLENE INSENSITIVE 3
4zds_B6e-841753062133Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4677830.0AF467783.1 Vigna radiata transcription factor EIL2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146084.10.0hypothetical protein PHAVU_006G011300g
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLV7BM200.0V7BM20_PHAVU; Uncharacterized protein
STRINGGLYMA13G03660.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein